GLP-1  – Research Peptide Overview

Chemical Information

• Compound Name: GLP-1

• Synonyms: NN9535; Glucagon-Like Peptide-1 analog

• Chemical Formula: C187H291N45O59

• Molecular Weight: 4113.58 g/mol

• CAS Number: 910463-68-2

• Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG – (GLP-1 analog with fatty acid modification)

• Form: Lyophilized powder or sterile injectable solution for in vitro research use only

Research Summary

GLP-1 is a long-acting glucagon-like peptide-1 receptor agonist (GLP-1 RA) designed for metabolic and endocrine research applications. Structurally modified for enhanced stability and extended plasma half-life, GLP-1 analogs are utilized to study cellular mechanisms involved in insulin signaling, energy balance, and appetite control.

Preclinical research shows that GLP-1 analogs support investigations related to:

• Glucose regulation and insulin response

• Appetite and caloric intake

• Energy metabolism and body weight modulation

• Pancreatic β-cell function

• Lipid and cardiovascular markers

Mechanism of Action (Research Context)

GLP-1 acts by binding to GLP-1 receptors, leading to increased cAMP production, which stimulates glucose-dependent insulin secretion while suppressing glucagon release. This dual action makes it an important research target for studying glucose homeostasis, metabolic pathways, and endocrine signaling.

Supporting Literature:

• PubMed: GLP-1 receptor pharmacology and signaling

• PubMed: Structural analysis of GLP-1 analogs

• PubMed: Mechanistic studies on GLP-1 receptor activation

Potential Research Applications

1. Metabolic Research – Study of glucose homeostasis and insulin signaling.

2. Appetite Regulation – Exploration of hypothalamic GLP-1 pathways.

3. Endocrine Function – Investigation of pancreatic β-cell survival and function.

4. Cardiometabolic Research – Evaluation of lipid metabolism and vascular function.

5. Pharmacodynamics – Study of receptor affinity, degradation resistance, and half-life.

Storage and Handling

• Storage: –20°C (lyophilized); 2–8°C (reconstituted).

• Solubility: Soluble in sterile or bacteriostatic water.

• Stability: Protect from light and moisture; stable for short-term research use.

Specifications

Safety Information

For laboratory research only. Handle with gloves and protective eyewear. Avoid inhalation and direct contact with skin or mucosa. Dispose of materials per institutional biosafety guidelines.

Research Disclaimer

This product is provided for research use only. It is not approved by the FDA for human consumption, medical, or veterinary applications. GLP-1 is intended solely for in vitro testing and controlled animal studies. Information provided is for educational and scientific purposes to support qualified research professionals.