$100.00 Original price was: $100.00.$70.00Current price is: $70.00.
1 in stock (can be backordered)
Compound Name: GLP-1
Synonyms: NN9535; Glucagon-Like Peptide-1 analog
Chemical Formula: C187H291N45O59
Molecular Weight: 4113.58 g/mol
CAS Number: 910463-68-2
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG – (GLP-1 analog with fatty acid modification)
Form: Lyophilized powder or sterile injectable solution for in vitro research use only
GLP-1 is a long-acting glucagon-like peptide-1 receptor agonist (GLP-1 RA) designed for metabolic and endocrine research applications. Structurally modified for enhanced stability and extended plasma half-life, GLP-1 analogs are utilized to study cellular mechanisms involved in insulin signaling, energy balance, and appetite control.
Preclinical research shows that GLP-1 analogs support investigations related to:
Glucose regulation and insulin response
Appetite and caloric intake
Energy metabolism and body weight modulation
Pancreatic β-cell function
Lipid and cardiovascular markers
GLP-1 acts by binding to GLP-1 receptors, leading to increased cAMP production, which stimulates glucose-dependent insulin secretion while suppressing glucagon release. This dual action makes it an important research target for studying glucose homeostasis, metabolic pathways, and endocrine signaling.
Supporting Literature:
Metabolic Research – Study of glucose homeostasis and insulin signaling.
Appetite Regulation – Exploration of hypothalamic GLP-1 pathways.
Endocrine Function – Investigation of pancreatic β-cell survival and function.
Cardiometabolic Research – Evaluation of lipid metabolism and vascular function.
Pharmacodynamics – Study of receptor affinity, degradation resistance, and half-life.
Storage: –20°C (lyophilized); 2–8°C (reconstituted).
Solubility: Soluble in sterile or bacteriostatic water.
Stability: Protect from light and moisture; stable for short-term research use.
Parameter | Specification |
---|---|
Purity | ≥ 98% (HPLC) |
Appearance | White to off-white lyophilized powder |
Molecular Weight | 4113.58 g/mol |
Endotoxin Level | < 0.01 EU/µg |
pH Range | 4.5–7.5 |
For laboratory research only. Handle with gloves and protective eyewear. Avoid inhalation and direct contact with skin or mucosa. Dispose of materials per institutional biosafety guidelines.
This product is provided for research use only. It is not approved by the FDA for human consumption, medical, or veterinary applications. GLP-1 is intended solely for in vitro testing and controlled animal studies. Information provided is for educational and scientific purposes to support qualified research professionals.
Only logged in customers who have purchased this product may leave a review.
$100.00 Original price was: $100.00.$70.00Current price is: $70.00.
$110.00 Original price was: $110.00.$79.00Current price is: $79.00.
Reviews
There are no reviews yet.