Sale!
Product | GLP-2 10mg

GLP-2 10mg

Original price was: $130.00.Current price is: $92.00.

15 in stock (can be backordered)

CERTIFICATE OF ANALYSIS

CERTIFICATE OF ANALYSIS

Dont Forget to buy

Product Description — GLP-2 Peptide (Research Use)

Product Name: Glucagon-Like Peptide-2 (GLP-2)
Form: Lyophilized peptide
Intended Use: For laboratory research use only; not for human clinical use unless properly authorized

Key Identifiers


Mechanism of Action & Biological Activity

GLP-2 is a peptide hormone derived from post-translational cleavage of the proglucagon precursor (which also yields GLP-1). Wikipedia+2Echelon Biosciences+2 It is secreted by intestinal enteroendocrine L cells in response to nutrient ingestion and acts as a gut trophic and regulatory factor. www.rndsystems.com+2RxList+2

Physiological / pharmacological effects (preclinical and human):

  • Promotes intestinal mucosal growth, enhances epithelial cell proliferation, inhibits apoptosis in the gut lining. Wikipedia+3www.rndsystems.com+3PMC+3

  • Improves gastrointestinal absorption of nutrients, particularly post-resection or in intestinal injury models. PMC+4PMC+4PMC+4

  • Modulates motility, blood flow, and gut barrier function. RxList+4www.rndsystems.com+4PMC+4

  • In animal and human studies, GLP-2 analogs (e.g. teduglutide) have shown efficacy in reducing dependence on parenteral nutrition in short bowel syndrome (SBS) by improving absorptive capacity. RxList+3PMC+3PubMed+3

One engineered analog, teduglutide, is FDA-approved for adult and pediatric patients with SBS (intestinal failure) to reduce parenteral support. PubMed+3PMC+3PMC+3

Emerging GLP-2 analogs (glepaglutide, apraglutide) are under clinical investigation for expanded gastrointestinal indications. PubMed+2Medscape Reference+2


Regulatory & Safety Context

  • Regulatory status: The native GLP-2 peptide is not itself an FDA-approved drug for general therapeutic use; its analogs (such as teduglutide) are regulated pharmaceuticals. PMC+2PMC+2

  • Complete Response / regulatory review: For example, glepaglutide’s new drug application (NDA) received a Complete Response Letter (CRL) from FDA, requesting further data before approval. Pharmacy Times+1

  • Research / compounding warnings: The FDA has warned against use or sale of unapproved peptides or biologics (e.g. GLP-1 / GLP-2 / related compounds) marketed for human use under “research use only” labels. U.S. Food and Drug Administration

Important disclaimers (for label / description):

  • “For research use only. Not for use in diagnostic or therapeutic procedures in humans without appropriate regulatory approval.”

  • “This product has not been evaluated by the FDA for safety or efficacy in human use (unless explicitly approved).”

  • “Use under controlled conditions only; potential risks and side effects in humans may not be fully characterized.”


Sample Full Description (FDA-Style)

Product: Glucagon-Like Peptide-2 (GLP-2), 15 mg (lyophilized)
CAS: 223460-79-5
Molecular Weight: ~3,763.82 Da
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Description:
GLP-2 is a naturally occurring 33-amino acid peptide hormone derived from proglucagon cleavage in intestinal L cells, with trophic and regulatory functions in the gastrointestinal tract. When administered exogenously in preclinical or clinical settings, GLP-2 or its analogs can promote mucosal growth, enhance nutrient absorption, and support structural and functional recovery of the intestinal epithelium.

Mechanism:
Acts via the GLP-2 receptor expressed in gut tissues, triggering signaling cascades that enhance epithelial proliferation, reduce apoptosis, and modulate blood flow, barrier integrity, and motility.

Applications:
Widely used in basic and translational research on gut physiology, intestinal regeneration, nutrient absorption, short bowel syndrome, inflammatory bowel disease, and for screening of analogs or receptor modulators.

Usage Notes & Safety:

  • For laboratory or preclinical research use only.

  • Not approved for human therapeutic or diagnostic use unless authorized by regulatory bodies.

  • Handle under sterile, controlled conditions.

  • May require reconstitution in appropriate buffers (e.g., sterile water or buffered saline) depending on downstream assay.

  • Store at –20 °C or colder, avoid freeze-thaw cycles, protect from moisture.

References / Related Literature (PubMed):

  1. Therapeutic Potential of GLP-2 Analogs in Gastrointestinal Disorders — PubMed PubMed

  2. GLP-2 Analogs as First Specific Treatment of Intestinal Failure — PMC article PMC

  3. GLP-2 regulation of intestinal lipid handling — PMC article PMC

Safety & Regulatory Notice:
This peptide has not been cleared or approved by the U.S. Food and Drug Administration for general medical use. Use is restricted to authorized research. Improper use or administration in humans may carry unknown risks or adverse effects. Users should comply with applicable institutional, regulatory, and ethical guidelines.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recent Products

Related Products

Original price was: $100.00.Current price is: $70.00.

Original price was: $75.00.Current price is: $50.00.

Original price was: $80.00.Current price is: $55.00.

Original price was: $65.00.Current price is: $55.00.

0